PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00075662001
Common NameGSBRNA2T00075662001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 398aa    MW: 44239.6 Da    PI: 5.6787
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00075662001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32201255155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fv+a++qLGGse+AtPk++l+l++ +gLt++hvkSHLQkYR+
  GSBRNA2T00075662001 201 KQRMRWTPELHEAFVDAINQLGGSERATPKAVLKLINSPGLTIYHVKSHLQKYRT 255
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.862198258IPR017930Myb domain
SuperFamilySSF466898.24E-17199255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-30200257IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-23201255IPR006447Myb domain, plants
PfamPF002495.3E-10203254IPR001005SANT/Myb domain
PfamPF143792.3E-22289335IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MTLTGDFGFP PTAMSSFFPL LPATLDERYN HHKSPNSLWV SSSGQEPMNN PVPCQVFPLV  60
SGGTSSGFCN GTYVSSHERS SSQTRQSVET QPLPVTNQPQ EQRDVSWPED QLQGFFDFPP  120
QAESSRAKSE WPDWANQMIS VGDGLGPNWS ELLGDPNVLN QDSKIPTPSC DIARQEIVVS  180
TQHQVDPSSA KSPQASSMTS KQRMRWTPEL HEAFVDAINQ LGGSERATPK AVLKLINSPG  240
LTIYHVKSHL QKYRTARYKP EISVDTEKPP LKTLKTIEDI KSLDLKTSIE ITEALRLQME  300
VQKKLHEQLE VQRTLQLQIE EQGRYLQMMI EKQQQKMQEK KIGSSSGSSL MPEADTSSAP  360
SPDLSQVSIT ERLQSDSGTL DQSGYPSLAT KKRVRED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00075662001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587724.10.0PREDICTED: protein PHR1-LIKE 1 isoform X2
SwissprotQ8GUN51e-130PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078I0240.0A0A078I024_BRANA; BnaC05g47270D protein
STRINGBra040196.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.11e-173G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]